PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5AL_E566BD64E.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 66aa    MW: 7512.81 Da    PI: 10.6286
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5AL_E566BD64E.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY77.12e-241481259
                           EE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY 12 qKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                           qK+vkg++ prsYY+Ct ++C+v+k++er+++dp++v +tY+g+Hnh+
  Traes_5AL_E566BD64E.1  1 QKVVKGNPRPRSYYKCTAENCNVRKQIERASTDPRCVLTTYTGRHNHD 48
                           9**********************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007742.6E-18149IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.5E-21150IPR003657WRKY domain
PROSITE profilePS5081126.314150IPR003657WRKY domain
PfamPF031068.1E-17148IPR003657WRKY domain
SuperFamilySSF1182907.98E-19150IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 66 aa     Download sequence    Send to blast
QKVVKGNPRP RSYYKCTAEN CNVRKQIERA STDPRCVLTT YTGRHNHDPP GRGAGXXXXX  60
XXRLLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-221502877Probable WRKY transcription factor 4
2lex_A8e-221502877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3638038e-71AK363803.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2019A07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014661260.15e-30PREDICTED: probable WRKY transcription factor 26
SwissprotQ9ZQ705e-21WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLW5F2G12e-36W5F2G1_WHEAT; Uncharacterized protein
STRINGSi034188m9e-30(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28753236
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.13e-22WRKY DNA-binding protein 3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]